CK1 epsilon anticorps (N-Term)

N° du produit ABIN630641

Détail du produit anti-CK1 epsilon anticorps

Antigène: CK1 epsilon (CSNK1E) (Casein Kinase 1, epsilon (CSNK1E))

Épitope: N-Term

Reactivité: Humain, Souris, Rat, Drosophila melanogaster

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CK1 epsilon est non-conjugé

Application: Western Blotting (WB)

Specificité: CK1 epsilon antibody was raised against the N terminal of CSNK1 E

Purification: Affinity purified

Immunogène: CK1 epsilon antibody was raised using the N terminal of CSNK1 E corresponding to a region with amino acids MELRVGNKYRLGRKIGSGSFGDIYLGANIASGEEVAIKLECVKTKHPQLH

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CK1 epsilon Blocking Peptide, catalog no. 33R-5936, is also available for use as a blocking control in assays to test for specificity of this CK1 epsilon antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CSNK0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CK1 epsilon

Antigène: CK1 epsilon (CSNK1E) (Casein Kinase 1, epsilon (CSNK1E))

Autre désignation: CK1 epsilon (CSNK1E Produits)

Synonymes: anticorps CKIepsilon, anticorps HCKIE, anticorps CKIe, anticorps ck1-epsilon, anticorps ck1epsilon, anticorps hckie, anticorps dco, anticorps fj38c01, anticorps wu:fj38c01, anticorps wu:fj62a04, anticorps zgc:77310, anticorps AI426939, anticorps AI551861, anticorps AW457082, anticorps CK1epsilon, anticorps KC1epsilon, anticorps tau, anticorps ckie, anticorps CSNK1E, anticorps Csnk1e, anticorps CKI-epsilon, anticorps 0538/13, anticorps 0915/10, anticorps 1396/02, anticorps 1447/01, anticorps 1460/09, anticorps CG2048, anticorps CK1delta/epsilon, anticorps DBT, anticorps DBT/CK1epsilon, anticorps DCO, anticorps DCO/CKIe, anticorps Dbt, anticorps Dco, anticorps Dco/CK1, anticorps Dmel\CG2048, anticorps dCKIepsilon, anticorps dbt, anticorps dco-1, anticorps ddbt, anticorps l(3)S053813, anticorps l(3)S144701, anticorps l(3)dco, anticorps l(3)dco-1, anticorps l(3)discs overgrown, anticorps l(3)discs overgrown-1, anticorps l(3)j3B9, anticorps l(3)rK215, anticorps casein kinase 1 epsilon, anticorps casein kinase 1, epsilon, anticorps casein kinase 1 epsilon L homeolog, anticorps casein kinase I isoform epsilon, anticorps casein kinase I epsilon, anticorps casein kinase I, anticorps LOC400927-CSNK1E readthrough, anticorps discs overgrown, anticorps CSNK1E, anticorps csnk1e, anticorps Csnk1e, anticorps csnk1e.L, anticorps LOC443240, anticorps NAEGRDRAFT_82890, anticorps LOC100407384, anticorps LOC100523244, anticorps LOC100607246, anticorps LOC100727500, anticorps LOC400927-CSNK1E, anticorps dco

Sujet: Casein kinases are operationally defined by their preferential utilization of acidic proteins such as caseins as substrates. CSNK1E can phosphorylate a large number of proteins. CSNK1E participates in Wnt signaling and is the central component of the circadian clock. It may act as a negative regulator of circadian rhythmicity by phosphorylating PER1 and PER2. CSNK1E inhibits cytokine-induced granuloytic differentiation.

Poids moléculaire: 47 kDa (MW of target protein)

Pathways: Signalisation Hedgehog, M Phase