TRIB2 anticorps

N° du produit ABIN630642

Détail du produit anti-TRIB2 anticorps

Antigène: TRIB2 (Tribbles Pseudokinase 2 (TRIB2))

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TRIB2 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: TRIB2 antibody was raised using a synthetic peptide corresponding to a region with amino acids YPFHDIEPSSLFSKIRRGQFNIPETLSPKAKCLIRSILRREPSERLTSQE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TRIB2 Blocking Peptide, catalog no. 33R-10196, is also available for use as a blocking control in assays to test for specificity of this TRIB2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRIB2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TRIB2

Antigène: TRIB2 (Tribbles Pseudokinase 2 (TRIB2))

Autre désignation: TRIB2 (TRIB2 Produits)

Synonymes: anticorps TRIB2, anticorps Trb2, anticorps Xtrbl, anticorps gs3955, anticorps c5fw, anticorps trb2, anticorps xtrb2, anticorps TRB2, anticorps C5FW, anticorps GS3955, anticorps TRB-2, anticorps AW319517, anticorps RGD1564451, anticorps tribbles pseudokinase 2, anticorps tribbles pseudokinase 2 S homeolog, anticorps TRIB2, anticorps trib2, anticorps trib2.S, anticorps Trib2

Sujet: TRIB2 is one of three members of the Tribbles family. The Tribbles members share a Trb domain, which is homologous to protein serine-threonine kinases, but lacks the active site lysine and probably lacks a catalytic function. The Tribbles proteins interact and modulate the activity of signal transduction pathways in a number of physiological and pathological processes. This Tribbles member induces apoptosis of cells mainly of the hematopoietic origin. It has been identified as a protein up-regulated by inflammatory stimuli in myeloid (THP-1) cells, and also as an oncogene that inactivates the transcription factor C/EBPalpha (CCAAT/enhancer-binding protein alpha) and causes acute myelogenous leukemia.

Poids moléculaire: 39 kDa (MW of target protein)