KPNA6 anticorps

N° du produit ABIN630643

Détail du produit anti-KPNA6 anticorps

Antigène: KPNA6 (Karyopherin alpha 6 (Importin alpha 7) (KPNA6))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp KPNA6 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: Karyopherin Alpha 6 antibody was raised using a synthetic peptide corresponding to a region with amino acids STTGESVITREMVEMLFSDDSDLQLATTQKFRKLLSKEPSPPIDEVINTP

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Karyopherin Alpha 6 Blocking Peptide, catalog no. 33R-8891, is also available for use as a blocking control in assays to test for specificity of this Karyopherin Alpha 6 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KPNA6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur KPNA6

Antigène: KPNA6 (Karyopherin alpha 6 (Importin alpha 7) (KPNA6))

Autre désignation: Karyopherin alpha 6 (KPNA6 Produits)

Synonymes: anticorps IPOA7, anticorps Kpna5, anticorps NPI-2, anticorps KPNA7, anticorps karyopherin subunit alpha 6, anticorps karyopherin (importin) alpha 6, anticorps karyopherin alpha 6 (importin alpha 7), anticorps karyopherin alpha 6 (importin alpha 7) S homeolog, anticorps KPNA6, anticorps Kpna6, anticorps kpna6.S

Sujet: The import of proteins containing a nuclear localization signal (NLS) requires the NLS import receptor, a heterodimer of importin alpha and beta subunits also known as karyopherins. Importin alpha binds the NLS-containing cargo in the cytoplasm and importin beta docks the complex at the cytoplasmic side of the nuclear pore complex. In the presence of nucleoside triphosphates and the small GTP binding protein Ran, the complex moves into the nuclear pore complex and the importin subunits dissociate. Importin alpha enters the nucleoplasm with its passenger protein and importin beta remains at the pore. KPNA6 is a member of the importin alpha family.

Poids moléculaire: 60 kDa (MW of target protein)

Pathways: Protein targeting to Nucleus