Raly anticorps (N-Term)
-
- Antigène Voir toutes Raly (RALY) Anticorps
- Raly (RALY) (RNA-binding protein Raly (RALY))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp Raly est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificité
- RALY antibody was raised against the N terminal of RALY
- Purification
- Affinity purified
- Immunogène
- RALY antibody was raised using the N terminal of RALY corresponding to a region with amino acids NKNDPKSINSRVFIGNLNTALVKKSDVETIFSKYGRVAGCSVHKGYAFVQ
- Top Product
- Discover our top product RALY Anticorps primaire
-
anti-RNA-binding protein Raly (RALY) (AA 254-306) antibody
RALY Reactivité: Humain WB, ELISA, IHC, IF Hôte: Lapin Polyclonal unconjugated
anti-RNA-binding protein Raly (RALY) (AA 1-307) antibodyRALY Reactivité: Humain WB, IF Hôte: Souris Polyclonal unconjugated
anti-RNA-binding protein Raly (RALY) (Internal Region) antibodyRALY Reactivité: Humain, Souris, Rat WB, ELISA, IHC, IF, ICC Hôte: Lapin Polyclonal unconjugated
anti-RNA-binding protein Raly (RALY) (AA 96-306) antibodyRALY Reactivité: Humain WB Hôte: Lapin Polyclonal unconjugated
anti-RNA-binding protein Raly (RALY) (C-Term) antibodyRALY Reactivité: Humain, Souris, Rat, Chien, Boeuf (Vache), Cobaye, Lapin, Cheval, Singe, Porc, Hamster WB, IHC, IHC (p) Hôte: Lapin Polyclonal unconjugated
anti-RNA-binding protein Raly (RALY) (N-Term) antibodyRALY Reactivité: Humain, Souris, Rat, Chien, Boeuf (Vache), Cobaye, Cheval, Poisson zèbre (Danio rerio), Singe, Porc, Hamster, Poulet WB, IHC, IHC (p) Hôte: Lapin Polyclonal unconjugated
anti-RNA-binding protein Raly (RALY) (C-Term) antibodyRALY Reactivité: Humain, Souris, Rat, Chien WB, IHC Hôte: Lapin Polyclonal unconjugated
anti-RNA-binding protein Raly (RALY) (C-Term) antibodyRALY Reactivité: Humain, Souris, Rat, Chien, Boeuf (Vache), Cobaye, Lapin, Cheval WB, IHC Hôte: Lapin Polyclonal unconjugated
anti-RNA-binding protein Raly (RALY) (N-Term) antibodyRALY Reactivité: Humain, Souris, Rat, Chien, Boeuf (Vache), Cobaye, Lapin, Cheval, Poisson zèbre (Danio rerio), Chévre WB, IHC Hôte: Lapin Polyclonal unconjugated
anti-RNA-binding protein Raly (RALY) (Internal Region) antibodyRALY Reactivité: Humain, Souris, Rat WB, ELISA Hôte: Lapin Polyclonal unconjugated
-
- Indications d'application
-
WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
RALY Blocking Peptide, catalog no. 33R-6745, is also available for use as a blocking control in assays to test for specificity of this RALY antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RALY antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- Raly (RALY) (RNA-binding protein Raly (RALY))
- Autre désignation
- RALY (RALY Produits)
- Synonymes
- anticorps AI663842, anticorps Merc, anticorps HNRPCL2, anticorps P542, anticorps zgc:103445, anticorps hnRNP-associated with lethal yellow, anticorps RALY heterogeneous nuclear ribonucleoprotein, anticorps Raly, anticorps RALY, anticorps raly
- Sujet
- In infectious mononucleosis, anti-EBNA-1 antibodies are produced which cross-react with multiple normal human proteins. The cross-reactivity is due to anti-gly/ala antibodies that cross-react with host proteins containing configurations like those in the EBNA-1 repeat. One such antigen is RALY which is a member of the heterogeneous nuclear ribonucleoprotein gene family.
- Poids moléculaire
- 30 kDa (MW of target protein)
-
