KIF5A anticorps (Middle Region)
-
- Antigène Voir toutes KIF5A Anticorps
- KIF5A (Kinesin Family Member 5A (KIF5A))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp KIF5A est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificité
- KIF5 A antibody was raised against the middle region of KIF5
- Purification
- Affinity purified
- Immunogène
- KIF5 A antibody was raised using the middle region of KIF5 corresponding to a region with amino acids LEESYDSLSDELAKLQAQETVHEVALKDKEPDTQDADEVKKALELQMESH
- Top Product
- Discover our top product KIF5A Anticorps primaire
-
-
- Indications d'application
-
WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
KIF5A Blocking Peptide, catalog no. 33R-4894, is also available for use as a blocking control in assays to test for specificity of this KIF5A antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KIF0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- KIF5A (Kinesin Family Member 5A (KIF5A))
- Autre désignation
- KIF5A (KIF5A Produits)
- Synonymes
- anticorps KIF5A, anticorps kif5a, anticorps si:ch211-166e11.4, anticorps wu:fj61a10, anticorps nkhc, anticorps my050, anticorps spg10, anticorps d12s1889, anticorps MGC122802, anticorps D12S1889, anticorps MY050, anticorps NKHC, anticorps SPG10, anticorps D10Bwg0738e, anticorps Khc, anticorps Kif5, anticorps Kns, anticorps mKIAA4086, anticorps kinesin family member 5A, anticorps kinesin family member 5A, a, anticorps KIF5A, anticorps kif5aa, anticorps kif5a, anticorps Kif5a
- Sujet
- KIF5A is a member of the kinesin family of proteins. Members of this family are part of a multisubunit complex that functions as a microtubule motor in intracellular organelle transport. Mutations in this gene cause autosomal dominant spastic paraplegia 10.
- Poids moléculaire
- 117 kDa (MW of target protein)
-