HIPK1 anticorps (Middle Region)
-
- Antigène Voir toutes HIPK1 Anticorps
- HIPK1 (Homeodomain Interacting Protein Kinase 1 (HIPK1))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp HIPK1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- HIPK1 antibody was raised against the middle region of HIPK1
- Purification
- Affinity purified
- Immunogène
- HIPK1 antibody was raised using the middle region of HIPK1 corresponding to a region with amino acids PLNLSQNQQSSAAPTSQERSSNPAPRRQQAFVAPLSQAPYTFQHGSPLHS
- Top Product
- Discover our top product HIPK1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
HIPK1 Blocking Peptide, catalog no. 33R-7200, is also available for use as a blocking control in assays to test for specificity of this HIPK1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HIPK1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- HIPK1 (Homeodomain Interacting Protein Kinase 1 (HIPK1))
- Autre désignation
- HIPK1 (HIPK1 Produits)
- Synonymes
- anticorps HIPK1, anticorps myak, anticorps nbak2, anticorps hipk1, anticorps Myak, anticorps Nbak2, anticorps 1110062K04Rik, anticorps homeodomain interacting protein kinase 1, anticorps homeodomain interacting protein kinase 1 L homeolog, anticorps homeodomain interacting protein kinase 1 S homeolog, anticorps HIPK1, anticorps hipk1.L, anticorps hipk1, anticorps hipk1.S, anticorps Hipk1
- Sujet
- HIPK1 may play a role as a corepressor for homeodomain transcription factors. HIPK1 phosphorylates DAXX in response to stress, and mediates its translocation from the nucleus to the cytoplasm. HIPK1 may be involved in malignant squamous cell tumor formation.
- Poids moléculaire
- 131 kDa (MW of target protein)
-