PPAT anticorps (N-Term)
-
- Antigène Voir toutes PPAT Anticorps
- PPAT (Phosphoribosyl Pyrophosphate Amidotransferase (PPAT))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp PPAT est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificité
- PPAT antibody was raised against the N terminal of PPAT
- Purification
- Affinity purified
- Immunogène
- PPAT antibody was raised using the N terminal of PPAT corresponding to a region with amino acids VTSDGSSVPTFKSHKGMGLVNHVFTEDNLKKLYVSNLGIGHTRYATTGKC
- Top Product
- Discover our top product PPAT Anticorps primaire
-
-
- Indications d'application
-
WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
PPAT Blocking Peptide, catalog no. 33R-9857, is also available for use as a blocking control in assays to test for specificity of this PPAT antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PPAT antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- PPAT (Phosphoribosyl Pyrophosphate Amidotransferase (PPAT))
- Autre désignation
- PPAT (PPAT Produits)
- Synonymes
- anticorps ATASE, anticorps GPAT, anticorps PRAT, anticorps Atase, anticorps 5730454C12Rik, anticorps AA408689, anticorps AA675351, anticorps AI507113, anticorps C79945, anticorps im:6894693, anticorps si:dkeyp-117h8.5, anticorps wu:fb61f03, anticorps wu:fc28b09, anticorps phosphoribosyl pyrophosphate amidotransferase, anticorps phosphoribosyl pyrophosphate amidotransferase L homeolog, anticorps PPAT, anticorps Ppat, anticorps ppat.L, anticorps ppat
- Sujet
- PPAT is a member of the purine/pyrimidine phosphoribosyltransferase family. This protein is a regulatory allosteric enzyme that catalyzes the first step of de novo purine nucleotide biosynthesis. Its gene and PAICS/AIRC, a bifunctional enzyme catalyzing steps six and seven in the purine nucleotide biosynthesis pathway, are located in close proximity on chromosome 4.
- Poids moléculaire
- 56 kDa (MW of target protein)
-