LPP anticorps (N-Term)

N° du produit ABIN630655

Détail du produit anti-LPP anticorps

Antigène: LPP (Lipoma-preferred partner (LPP))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp LPP est non-conjugé

Application: Western Blotting (WB)

Specificité: LPP antibody was raised against the N terminal of LPP

Purification: Affinity purified

Immunogène: LPP antibody was raised using the N terminal of LPP corresponding to a region with amino acids GKTLEERRSSLDAEIDSLTSILADLECSSPYKPRPPQSSTGSTASPPVST

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

LPP Blocking Peptide, catalog no. 33R-3379, is also available for use as a blocking control in assays to test for specificity of this LPP antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LPP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur LPP

Antigène: LPP (Lipoma-preferred partner (LPP))

Autre désignation: LPP (LPP Produits)

Synonymes: anticorps 9430020K16Rik, anticorps AA959454, anticorps AU024130, anticorps B130055L10Rik, anticorps C79715, anticorps D630048H16, anticorps LIM domain containing preferred translocation partner in lipoma, anticorps LPP, anticorps Lpp

Sujet: LPP may play a structural role at sites of cell adhesion in maintaining cell shape and motility. In addition to these structural functions, it may also be implicated in signaling events and activation of gene transcription. LPP may be involved in signal transduction from cell adhesion sites to the nucleus allowing successful integration of signals arising from soluble factors and cell-cell adhesion sites. LPP is also suggested to serve as a scaffold protein upon which distinct protein complexes are assembled in the cytoplasm and in the nucleus.

Poids moléculaire: 67 kDa (MW of target protein)