TSSK2 anticorps (Middle Region)

N° du produit ABIN630656

Détail du produit anti-TSSK2 anticorps

Antigène: TSSK2 (Testis-Specific serine Kinase 2 (TSSK2))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TSSK2 est non-conjugé

Application: Western Blotting (WB)

Specificité: TSSK2 antibody was raised against the middle region of TSSK2

Purification: Affinity purified

Immunogène: TSSK2 antibody was raised using the middle region of TSSK2 corresponding to a region with amino acids RMLQPDVSQRLHIDEILSHSWLQPPKPKATSSASFKREGEGKYRAECKLD

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TSSK2 Blocking Peptide, catalog no. 33R-8066, is also available for use as a blocking control in assays to test for specificity of this TSSK2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TSSK2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TSSK2

Antigène: TSSK2 (Testis-Specific serine Kinase 2 (TSSK2))

Autre désignation: TSSK2 (TSSK2 Produits)

Synonymes: anticorps DGS-G, anticorps SPOGA2, anticorps STK22B, anticorps TSK2, anticorps Stk22b, anticorps Tsk2, anticorps TSSK2, anticorps testis specific serine kinase 2, anticorps testis-specific serine kinase 2, anticorps testis-specific serine/threonine-protein kinase 2, anticorps TSSK2, anticorps Tssk2, anticorps LOC486426, anticorps LOC100471688

Sujet: TSSK2 belongs to a family of serine/threonine kinases highly expressed in testis.

Poids moléculaire: 39 kDa (MW of target protein)