MAP3K15 anticorps (Middle Region)
-
- Antigène Voir toutes MAP3K15 Anticorps
- MAP3K15 (Mitogen-Activated Protein Kinase Kinase Kinase 15 (MAP3K15))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp MAP3K15 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- MAP3 K15 antibody was raised against the middle region of MAP3 15
- Purification
- Affinity purified
- Immunogène
- MAP3 K15 antibody was raised using the middle region of MAP3 15 corresponding to a region with amino acids TLEQKTQELYHLQLKLKSNCITENPAGPYGQRTDKELIDWLRLQGADAKT
- Top Product
- Discover our top product MAP3K15 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
MAP3K15 Blocking Peptide, catalog no. 33R-9170, is also available for use as a blocking control in assays to test for specificity of this MAP3K15 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAP0 15 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- MAP3K15 (Mitogen-Activated Protein Kinase Kinase Kinase 15 (MAP3K15))
- Autre désignation
- MAP3K15 (MAP3K15 Produits)
- Synonymes
- anticorps MCO15.4, anticorps MCO15_4, anticorps mitogen-activated protein kinase kinase kinase 15, anticorps ASK3, anticorps bA723P2.3, anticorps BC031147, anticorps MEKK15, anticorps mitogen-activated protein kinase kinase kinase 15, anticorps MAPKKK15, anticorps MAP3K15, anticorps Map3k15
- Sujet
- MAP3K15 is a component of a protein kinase signal transduction cascade.
- Poids moléculaire
- 89 kDa (MW of target protein)
-