KPNA3 anticorps
-
- Antigène Voir toutes KPNA3 Anticorps
- KPNA3 (Karyopherin alpha 3 (Importin alpha 4) (KPNA3))
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp KPNA3 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- Karyopherin Alpha 3 antibody was raised using a synthetic peptide corresponding to a region with amino acids AENPSLENHRIKSFKNKGRDVETMRRHRNEVTVELRKNKRDEHLLKKRNV
- Top Product
- Discover our top product KPNA3 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
Karyopherin Alpha 3 Blocking Peptide, catalog no. 33R-1141, is also available for use as a blocking control in assays to test for specificity of this Karyopherin Alpha 3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KPNA3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- KPNA3 (Karyopherin alpha 3 (Importin alpha 4) (KPNA3))
- Autre désignation
- Karyopherin alpha 3 (KPNA3 Produits)
- Synonymes
- anticorps IPOA4, anticorps si:dz79f24.2, anticorps importin, anticorps SRP1, anticorps SRP1gamma, anticorps SRP4, anticorps hSRP1, anticorps ipoa4, anticorps srp1, anticorps srp1gamma, anticorps srp4, anticorps karyopherin (importin) alpha 3, anticorps karyopherin alpha 3 (importin alpha 4), anticorps karyopherin subunit alpha 3, anticorps karyopherin alpha 3 (importin alpha 4) L homeolog, anticorps Kpna3, anticorps kpna3, anticorps KPNA3, anticorps kpna3.L
- Sujet
- The transport of molecules between the nucleus and the cytoplasm in eukaryotic cells is mediated by the nuclear pore complex (NPC) which consists of 60-100 proteins and is probably 120 million daltons in molecular size. Small molecules (up to 70 kDa) can pass through the nuclear pore by nonselective diffusion, larger molecules are transported by an active process. Most nuclear proteins contain short basic amino acid sequences known as nuclear localization signals (NLSs). KPNA3 is a protein similar to certain nuclear transport proteins of Xenopus and human.
- Poids moléculaire
- 58 kDa (MW of target protein)
- Pathways
- Protein targeting to Nucleus
-