ING3 anticorps (N-Term)

N° du produit ABIN630670

Détail du produit anti-ING3 anticorps

Antigène: ING3 (Inhibitor of Growth Family, Member 3 (ING3))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ING3 est non-conjugé

Application: Western Blotting (WB)

Specificité: ING3 antibody was raised against the N terminal of ING3

Purification: Affinity purified

Immunogène: ING3 antibody was raised using the N terminal of ING3 corresponding to a region with amino acids MDQLEQRVSEFFMNAKKNKPEWREEQMASIKKDYYKALEDADEKVQLANQ

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ING3 Blocking Peptide, catalog no. 33R-5862, is also available for use as a blocking control in assays to test for specificity of this ING3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ING3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ING3

Antigène: ING3 (Inhibitor of Growth Family, Member 3 (ING3))

Autre désignation: ING3 (ING3 Produits)

Synonymes: anticorps ING3, anticorps Eaf4, anticorps ING2, anticorps MEAF4, anticorps p47ING3, anticorps 1300013A07Rik, anticorps P47ING3, anticorps zgc:56327, anticorps inhibitor of growth family member 3, anticorps inhibitor of growth family, member 3, anticorps inhibitor of growth protein 3, anticorps inhibitor of growth family member 3 L homeolog, anticorps ING3, anticorps Ing3, anticorps CpipJ_CPIJ009396, anticorps ing3, anticorps ing3.L

Sujet: ING3 is similar to ING1, a tumor suppressor protein that can interact with TP53, inhibit cell growth, and induce apoptosis. This protein contains a PHD-finger, which is a common motif in proteins involved in chromatin remodeling. This gene can activate p53 trans-activated promoters, including promoters of p21/waf1 and bax. Overexpression of this gene has been shown to inhibit cell growth and induce apoptosis. Allelic loss and reduced expression of this gene were detected in head and neck cancers.

Poids moléculaire: 47 kDa (MW of target protein)