RNF20 anticorps (N-Term)

N° du produit ABIN630671

Détail du produit anti-RNF20 anticorps

Antigène: RNF20 (Ring Finger Protein 20 (RNF20))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RNF20 est non-conjugé

Application: Western Blotting (WB)

Specificité: RNF20 antibody was raised against the N terminal of RNF20

Purification: Affinity purified

Immunogène: RNF20 antibody was raised using the N terminal of RNF20 corresponding to a region with amino acids LKRYDLEQGLGDLLTERKALVVPEPEPDSDSNQERKDDRERGEGQEPAFS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RNF20 Blocking Peptide, catalog no. 33R-5103, is also available for use as a blocking control in assays to test for specificity of this RNF20 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RNF20 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RNF20

Antigène: RNF20 (Ring Finger Protein 20 (RNF20))

Autre désignation: RNF20 (RNF20 Produits)

Synonymes: anticorps 4833430L21Rik, anticorps AW540162, anticorps C79397, anticorps mKIAA4116, anticorps BRE1, anticorps BRE1A, anticorps hBRE1, anticorps ring finger protein 20, anticorps RNF20, anticorps Rnf20

Sujet: RNF20 shares similarity with BRE1 of S. cerevisiae. Yeast BRE1 is an ubiquitin ligase required for the ubiquitination of histone H2B and the methylation of histone H3.

Poids moléculaire: 114 kDa (MW of target protein)