MSL2 anticorps

N° du produit ABIN630673

Détail du produit anti-MSL2 anticorps

Antigène: MSL2 (Male-Specific Lethal 2 Homolog (MSL2))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MSL2 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: MSL2 L1 antibody was raised using a synthetic peptide corresponding to a region with amino acids NPVNATALYISASRLVLNYDPGDPKAFTEINRLLPYFRQSLSCCVCGHLL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MSL2L1 Blocking Peptide, catalog no. 33R-6835, is also available for use as a blocking control in assays to test for specificity of this MSL2L1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MSL0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MSL2

Antigène: MSL2 (Male-Specific Lethal 2 Homolog (MSL2))

Autre désignation: MSL2L1 (MSL2 Produits)

Synonymes: anticorps MSL-2, anticorps MSL2L1, anticorps RNF184, anticorps E130103E02Rik, anticorps Msl2l1, anticorps Rnf184, anticorps RGD1310355, anticorps MSL complex subunit 2, anticorps male-specific lethal 2 homolog (Drosophila), anticorps MSL2, anticorps Msl2

Sujet: MSL2L1 is the component of histone acetyltransferase complex responsible for the majority of histone H4 acetylation at lysine 16 which is implicated in the formation of higher-order chromatin structure.

Poids moléculaire: 62 kDa (MW of target protein)