PIM1 anticorps (N-Term)
-
- Antigène Voir toutes PIM1 Anticorps
- PIM1 (Pim-1 Oncogene (PIM1))
-
Épitope
- N-Term
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp PIM1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- PIM1 antibody was raised against the N terminal of PIM1
- Purification
- Affinity purified
- Immunogène
- PIM1 antibody was raised using the N terminal of PIM1 corresponding to a region with amino acids MLLSKINSLAHLRAAPCNDLHATKLAPGKEKEPLESQYQVGPLLGSGGFG
- Top Product
- Discover our top product PIM1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
PIM1 Blocking Peptide, catalog no. 33R-6196, is also available for use as a blocking control in assays to test for specificity of this PIM1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PIM1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- PIM1 (Pim-1 Oncogene (PIM1))
- Autre désignation
- PIM1 (PIM1 Produits)
- Synonymes
- anticorps PIM, anticorps Pim-1, anticorps PIM1, anticorps pim, anticorps pim-1, anticorps pim3, anticorps Pim-1 proto-oncogene, serine/threonine kinase, anticorps proviral integration site 1, anticorps Pim-1 proto-oncogene, serine/threonine kinase L homeolog, anticorps PIM1, anticorps Pim1, anticorps pim1, anticorps pim1.L
- Sujet
- PIM1 may affect the structure or silencing of chromatin by phosphorylating HP1 gamma/CBX3. Isoform 2 promotes the G1/S transition of the cell cycle via up-regulation of CDK2 activity and phosphorylation of CDKN1B.
- Poids moléculaire
- 36 kDa (MW of target protein)
- Pathways
- Glycosaminoglycan Metabolic Process
-