PIN4 anticorps (N-Term)
-
- Antigène Voir toutes PIN4 Anticorps
- PIN4 (Peptidyl Prolyl Cis/Trans Isomerase NIMA Interacting 4 Protein (PIN4))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp PIN4 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- PIN4 antibody was raised against the N terminal of PIN4
- Purification
- Affinity purified
- Immunogène
- PIN4 antibody was raised using the N terminal of PIN4 corresponding to a region with amino acids MPMAGLLKGLVRQLERFSVQQQASKMPPKGKSGSGKAGKGGAASGSDSAD
- Top Product
- Discover our top product PIN4 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
PIN4 Blocking Peptide, catalog no. 33R-6296, is also available for use as a blocking control in assays to test for specificity of this PIN4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PIN4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- PIN4 (Peptidyl Prolyl Cis/Trans Isomerase NIMA Interacting 4 Protein (PIN4))
- Autre désignation
- PIN4 (PIN4 Produits)
- Synonymes
- anticorps 2410002I22Rik, anticorps EPVH, anticorps Par14, anticorps PAR14, anticorps PAR17, anticorps zgc:110008, anticorps peptidylprolyl cis/trans isomerase, NIMA-interacting 4, anticorps protein (peptidyl-prolyl cis/trans isomerase) NIMA-interacting, 4 (parvulin), anticorps protein (peptidylprolyl cis/trans isomerase) NIMA-interacting, 4 (parvulin), anticorps PIN4, anticorps Pin4, anticorps pin4
- Sujet
- This gene encodes a member of the parvulin subfamily of the peptidyl-prolyl cis/trans isomerase protein family. The encoded protein catalyzes the isomerization of peptidylprolyl bonds, and may play a role in the cell cycle and chromatin remodeling.
- Poids moléculaire
- 16 kDa (MW of target protein)
-