RSF1 anticorps (Middle Region)
-
- Antigène Voir toutes RSF1 Anticorps
- RSF1 (Remodeling and Spacing Factor 1 (RSF1))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp RSF1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- RSF1 antibody was raised against the middle region of RSF1
- Purification
- Affinity purified
- Immunogène
- RSF1 antibody was raised using the middle region of RSF1 corresponding to a region with amino acids QDEFVVSDENPDESEEDPPSNDDSDTDFCSRRLRRHPSRPMRQSRRLRRK
- Top Product
- Discover our top product RSF1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
RSF1 Blocking Peptide, catalog no. 33R-7494, is also available for use as a blocking control in assays to test for specificity of this RSF1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RSF1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- RSF1 (Remodeling and Spacing Factor 1 (RSF1))
- Autre désignation
- RSF1 (RSF1 Produits)
- Synonymes
- anticorps Rsf-1, anticorps CG5655, anticorps Dmel\\CG5655, anticorps ROX21, anticorps RSF1, anticorps Rox21, anticorps rox21, anticorps hbxap, anticorps HBXAP, anticorps RSF-1, anticorps XAP8, anticorps p325, anticorps 4832420A03Rik, anticorps C030033M12Rik, anticorps Gm164, anticorps Hbxap, anticorps remodeling and spacing factor 1, anticorps Repressor splicing factor 1, anticorps remodeling and spacing factor 1 S homeolog, anticorps RSF1, anticorps Rsf1, anticorps rsf1.S
- Sujet
- RSF1 (HBXAP) is involved in transcription repression, transcription coactivation when associated with hepatitis B virus X protein (HBX), and chromatin remodeling and spacing when associated with SNF2H.HBXAP is involved in transcription repression, transcription coactivation when associated with hepatitis B virus X protein (HBX), and chromatin remodeling and spacing when associated with SNF2H.
- Poids moléculaire
- 164 kDa (MW of target protein)
-