H2AFY anticorps (N-Term)
-
- Antigène Voir toutes H2AFY Anticorps
- H2AFY (H2A Histone Family, Member Y (H2AFY))
-
Épitope
- N-Term
-
Reactivité
- Humain, Rat, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp H2AFY est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- H2 AFY antibody was raised against the N terminal of H2 FY
- Purification
- Affinity purified
- Immunogène
- H2 AFY antibody was raised using the N terminal of H2 FY corresponding to a region with amino acids HPKYRIGVGAPVYMAAVLEYLTAEILELAGNAARDNKKGRVTPRHILLAV
- Top Product
- Discover our top product H2AFY Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
H2AFY Blocking Peptide, catalog no. 33R-3812, is also available for use as a blocking control in assays to test for specificity of this H2AFY antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of H0 FY antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- H2AFY (H2A Histone Family, Member Y (H2AFY))
- Autre désignation
- H2AFY (H2AFY Produits)
- Synonymes
- anticorps H2A.y, anticorps H2A/y, anticorps H2AF12M, anticorps H2AFJ, anticorps MACROH2A1.1, anticorps mH2A1, anticorps macroH2A1.2, anticorps mH2a1, anticorps macroH2A1, anticorps wu:fa93c12, anticorps zgc:136891, anticorps h2a.y, anticorps h2a/y, anticorps h2af12m, anticorps h2afj, anticorps macroh2a, anticorps mh2a1, anticorps core histone macro-H2A.1, anticorps H2A histone family, member Y, anticorps H2A histone family member Y, anticorps H2A histone family member Y L homeolog, anticorps LOC100230612, anticorps H2AFY, anticorps LOC481514, anticorps H2afy, anticorps h2afy, anticorps h2afy.L
- Sujet
- Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. H2AFY is a member of the histone H2A family. It replaces conventional H2A histones in a subset of nucleosomes where it represses transcription and participates in stable X chromosome inactivation. Alternative splicing results in multiple transcript variants encoding different isoforms.
- Poids moléculaire
- 39 kDa (MW of target protein)
-