LOC642097 anticorps (N-Term)

N° du produit ABIN630692

Détail du produit anti-LOC642097 anticorps

Antigène: LOC642097

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Application: Western Blotting (WB)

Specificité: LOC642097 antibody was raised against the N terminal Of Loc642097

Purification: Affinity purified

Immunogène: LOC642097 antibody was raised using the N terminal Of Loc642097 corresponding to a region with amino acids MSDAHLGEAVDDIVSALKLGPGTVVPELRSLKPEAQALITQGLYSHCRAL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

LOC642097 Blocking Peptide, catalog no. 33R-6405, is also available for use as a blocking control in assays to test for specificity of this LOC642097 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LOC642097 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur LOC642097

Antigène: LOC642097

Autre désignation: LOC642097 (LOC642097 Produits)

Sujet: The function of LOC642097 protein has not been widely studied, and is yet to be fully elucidated.

Poids moléculaire: 37 kDa (MW of target protein)