GAPVD1 anticorps (N-Term)

N° du produit ABIN630695

Détail du produit anti-GAPVD1 anticorps

Antigène: GAPVD1 (GTPase Activating Protein and VPS9 Domains 1 (GAPVD1))

Épitope: N-Term

Reactivité: Humain, Souris, Chien, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GAPVD1 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: GAPVD1 antibody was raised against the N terminal of GAPVD1

Purification: Affinity purified

Immunogène: GAPVD1 antibody was raised using the N terminal of GAPVD1 corresponding to a region with amino acids FKLFSEGLFSAKLFLTATLHEPIMQLLVEDEDHLETDPNKLIERFSPSQQ

Information d'application

Indications d'application: WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GAPVD1 Blocking Peptide, catalog no. 33R-2950, is also available for use as a blocking control in assays to test for specificity of this GAPVD1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GAPVD1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur GAPVD1

Antigène: GAPVD1 (GTPase Activating Protein and VPS9 Domains 1 (GAPVD1))

Autre désignation: GAPVD1 (GAPVD1 Produits)

Synonymes: anticorps zgc:92666, anticorps GAPEX5, anticorps RAP6, anticorps 2010005B09Rik, anticorps 4432404J10Rik, anticorps AW108497, anticorps Gapex-5, anticorps RME-6, anticorps mKIAA1521, anticorps RGD1307479, anticorps GTPase activating protein and VPS9 domains 1, anticorps GTPase activating protein and VPS9 domains 1 S homeolog, anticorps LOAG_00609, anticorps GAPVD1, anticorps gapvd1, anticorps gapvd1.S, anticorps Gapvd1

Sujet: GAPVD1 acts both as a GTPase-activating protein (GAP) and a guanine nucleotide exchange factor (GEF), and participates in various processes such as endocytosis, insulin receptor internalization or LC2A4/GLUT4 trafficking. It acts as a GEF for the Ras-related protein RAB31 by exchanging bound GDP for free GTP, leading to regulate LC2A4/GLUT4 trafficking. In the absence of insulin, it maintains RAB31 in an active state and promotes a futile cycle between LC2A4/GLUT4 storage vesicles and early endosomes, retaining LC2A4/GLUT4 inside the cells. Upon insulin stimulation, it is translocated to the plasma membrane, releasing LC2A4/GLUT4 from intracellular storage vesicles. It is also involved in EGFR trafficking and degradation, possibly by promoting EGFR ubiquitination and subsequent degradation by the proteasome. It has GEF activity for Rab5 and GAP activity for Ras.

Poids moléculaire: 166 kDa (MW of target protein)