RBBP7 anticorps (N-Term)

N° du produit ABIN630697

Détail du produit anti-RBBP7 anticorps

Antigène: RBBP7 (Retinoblastoma Binding Protein 7 (RBBP7))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RBBP7 est non-conjugé

Application: Western Blotting (WB)

Specificité: RBBP7 antibody was raised against the N terminal of RBBP7

Purification: Affinity purified

Immunogène: RBBP7 antibody was raised using the N terminal of RBBP7 corresponding to a region with amino acids MTHALQWPSLTVQWLPEVTKPEGKDYALHWLVLGTHTSDEQNHLVVARVH

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RBBP7 Blocking Peptide, catalog no. 33R-6545, is also available for use as a blocking control in assays to test for specificity of this RBBP7 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RBBP7 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RBBP7

Antigène: RBBP7 (Retinoblastoma Binding Protein 7 (RBBP7))

Autre désignation: RBBP7 (RBBP7 Produits)

Synonymes: anticorps RbAp46, anticorps AA409861, anticorps AI173248, anticorps AU019541, anticorps BB114024, anticorps mRbAp46, anticorps rbap46, anticorps RBBP7, anticorps RBBP-7, anticorps Caf1, anticorps rbbp7, anticorps wu:fa13g08, anticorps wu:fb50h10, anticorps wu:fc29d09, anticorps zgc:56477, anticorps zgc:85617, anticorps CaO19.2146, anticorps RB binding protein 7, chromatin remodeling factor, anticorps retinoblastoma binding protein 7, chromatin remodeling factor, anticorps retinoblastoma binding protein 7 L homeolog, anticorps retinoblastoma binding protein 7, anticorps retinoblastoma binding protein 4, like, anticorps histone-binding protein RBBP7, anticorps Hat2p, anticorps RBBP7, anticorps Rbbp7, anticorps rbbp7.L, anticorps rbbp7, anticorps rbb4l, anticorps LOC108708306, anticorps HAT2

Sujet: This protein is a ubiquitously expressed nuclear protein and belongs to a highly conserved subfamily of WD-repeat proteins. It is found among several proteins that binds directly to retinoblastoma protein, which regulates cell proliferation.

Poids moléculaire: 48 kDa (MW of target protein)