HERC4 anticorps (N-Term)
-
- Antigène Voir toutes HERC4 Anticorps
- HERC4 (Hect Domain and RLD 4 (HERC4))
-
Épitope
- N-Term
-
Reactivité
- Humain, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp HERC4 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- HERC4 antibody was raised against the n terminal of HERC4
- Purification
- Affinity purified
- Immunogène
- HERC4 antibody was raised using the N terminal of HERC4 corresponding to a region with amino acids MLCWGNASFGQLGLGGIDEEIVLEPRKSDFFINKRVRDVGCGLRHTVFVL
- Top Product
- Discover our top product HERC4 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
HERC4 Blocking Peptide, catalog no. 33R-6183, is also available for use as a blocking control in assays to test for specificity of this HERC4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HERC4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- HERC4 (Hect Domain and RLD 4 (HERC4))
- Autre désignation
- HERC4 (HERC4 Produits)
- Synonymes
- anticorps 1700056O17Rik, anticorps 4921531D01Rik, anticorps 9530080M15Rik, anticorps mKIAA1593, anticorps HECT and RLD domain containing E3 ubiquitin protein ligase 4, anticorps HECT and RLD domain containing E3 ubiquitin protein ligase 4 S homeolog, anticorps hect domain and RLD 4, anticorps HERC4, anticorps herc4, anticorps herc4.S, anticorps Herc4
- Sujet
- HERC4 belongs to the HERC family of ubiquitin ligases, all of which contain a HECT domain and at least 1 RCC1-like domain (RLD). The 350-amino acid HECT domain is predicted to catalyze the formation of a thioester with ubiquitin before transferring it to a substrate, and the RLD is predicted to act as a guanine nucleotide exchange factor for small G proteins.
- Poids moléculaire
- 13 kDa (MW of target protein)
-