MKRN2 anticorps (N-Term)
-
- Antigène Voir toutes MKRN2 Anticorps
- MKRN2 (Makorin Ring Finger Protein 2 (MKRN2))
-
Épitope
- N-Term
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp MKRN2 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- MKRN2 antibody was raised against the N terminal of MKRN2
- Purification
- Affinity purified
- Immunogène
- MKRN2 antibody was raised using the N terminal of MKRN2 corresponding to a region with amino acids STKQITCRYFMHGVCREGSQCLFSHDLANSKPSTICKYYQKGYCAYGTRC
- Top Product
- Discover our top product MKRN2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
MKRN2 Blocking Peptide, catalog no. 33R-8870, is also available for use as a blocking control in assays to test for specificity of this MKRN2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MKRN2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- MKRN2 (Makorin Ring Finger Protein 2 (MKRN2))
- Autre désignation
- MKRN2 (MKRN2 Produits)
- Synonymes
- anticorps MKRN2, anticorps RNF62, anticorps MGC131105, anticorps mkrn2, anticorps Makorin-2, anticorps hspc070, anticorps wu:fb99a04, anticorps 2610002L04Rik, anticorps C81377, anticorps makorin ring finger protein 2, anticorps makorin ring finger protein 2 pseudogene, anticorps makorin ring finger protein 2 L homeolog, anticorps makorin-2, anticorps makorin, ring finger protein, 2, anticorps MKRN2, anticorps LOC100401355, anticorps mkrn2, anticorps mkrn2.L, anticorps Mkrn2
- Sujet
- Members of the makorin family, including MKRN2, have a characteristic zinc finger composition that suggests that they are ribonucleoproteins.
- Poids moléculaire
- 47 kDa (MW of target protein)
-