MKRN2 anticorps (C-Term)

N° du produit ABIN630704

Détail du produit anti-MKRN2 anticorps

Antigène: MKRN2 (Makorin Ring Finger Protein 2 (MKRN2))

Épitope: C-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MKRN2 est non-conjugé

Application: Western Blotting (WB)

Specificité: MKRN2 antibody was raised against the C terminal of MKRN2

Purification: Affinity purified

Immunogène: MKRN2 antibody was raised using the C terminal of MKRN2 corresponding to a region with amino acids ACKYFEQGKGTCPFGSKCLYRHAYPDGRLAEPEKPRKQLSSQGTVRFFNS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MKRN2 Blocking Peptide, catalog no. 33R-1071, is also available for use as a blocking control in assays to test for specificity of this MKRN2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MKRN2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MKRN2

Antigène: MKRN2 (Makorin Ring Finger Protein 2 (MKRN2))

Autre désignation: MKRN2 (MKRN2 Produits)

Synonymes: anticorps MKRN2, anticorps RNF62, anticorps MGC131105, anticorps mkrn2, anticorps Makorin-2, anticorps hspc070, anticorps wu:fb99a04, anticorps 2610002L04Rik, anticorps C81377, anticorps makorin ring finger protein 2, anticorps makorin ring finger protein 2 pseudogene, anticorps makorin ring finger protein 2 L homeolog, anticorps makorin-2, anticorps makorin, ring finger protein, 2, anticorps MKRN2, anticorps LOC100401355, anticorps mkrn2, anticorps mkrn2.L, anticorps Mkrn2

Sujet: Members of the makorin family, including MKRN2, have a characteristic zinc finger composition that suggests that they are ribonucleoproteins.

Poids moléculaire: 47 kDa (MW of target protein)