Deoxyuridine Triphosphatase (DUT) (N-Term) anticorps

N° du produit ABIN630705

Détail du produit

Antigène: Deoxyuridine Triphosphatase (DUT)

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Inconjugué

Application: Western Blotting (WB)

Specificité: DUT antibody was raised against the N terminal of DUT

Purification: Affinity purified

Immunogène: DUT antibody was raised using the N terminal of DUT corresponding to a region with amino acids AAVLSGPGPPLGRAAQHGIPRPLSSAGRLSQGCRGASTVGAAGWKGELPK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

DUT Blocking Peptide, catalog no. 33R-1060, is also available for use as a blocking control in assays to test for specificity of this DUT antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DUT antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détail du antigène

Antigène: Deoxyuridine Triphosphatase (DUT)

Autre désignation: DUT (DUT Produits)

Synonymes: anticorps BcDNA:LD08534, anticorps CG4584, anticorps Dmel\\CG4584, anticorps LD08534, anticorps UTPase, anticorps anon-SAGE:Wang-077, anticorps dUTPase, anticorps Tb07.27E10.390, anticorps dutpase, anticorps 5031412I06Rik, anticorps 5133400F09Rik, anticorps D2Bwg0749e, anticorps Dutp, anticorps PIP4, anticorps deoxyuridine triphosphatase, anticorps Deoxyuridine triphosphatase, anticorps dUTPase; ORF54; similar to EBV BLLF3, CMV UL72, HSV UL50, anticorps involved in nucleotide metabolism, anticorps tegument protein, anticorps dUTPase, anticorps deoxyuridine triphosphatase L homeolog, anticorps DUT, anticorps dUTPase, anticorps P18, anticorps AlHV1gp51, anticorps UL50, anticorps HVT058, anticorps ORF9, anticorps ORF8, anticorps U45, anticorps GAMMAHV.ORF54, anticorps Tc00.1047053509151.130, anticorps Tc00.1047053508175.160, anticorps Tb927.7.5160, anticorps dut.L, anticorps Dut

Classe de substances: Viral Protein

Sujet: DUT is an essential enzyme of nucleotide metabolism. This protein forms a ubiquitous, homotetrameric enzyme that hydrolyzes dUTP to dUMP and pyrophosphate. This reaction serves two cellular purposes: providing a precursor (dUMP) for the synthesis of thymine nucleotides needed for DNA replication, and limiting intracellular pools of dUTP. Elevated levels of dUTP lead to increased incorporation of uracil into DNA, which induces extensive excision repair mediated by uracil glycosylase. This repair process, resulting in the removal and reincorporation of dUTP, is self-defeating and leads to DNA fragmentation and cell death.

Poids moléculaire: 19 kDa (MW of target protein)