NUDT17 anticorps

N° du produit ABIN630706

Détail du produit anti-NUDT17 anticorps

Antigène: NUDT17 (Nudix (Nucleoside Diphosphate Linked Moiety X)-Type Motif 17 (NUDT17))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp NUDT17 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: NUDT17 antibody was raised using a synthetic peptide corresponding to a region with amino acids YPPRLSWGLPKYHHIVLYLLVISQESQQQLQARIQPNPNEVSALMWLTPD

Information d'application

Indications d'application: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

NUDT17 Blocking Peptide, catalog no. 33R-10206, is also available for use as a blocking control in assays to test for specificity of this NUDT17 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NUDT17 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur NUDT17

Antigène: NUDT17 (Nudix (Nucleoside Diphosphate Linked Moiety X)-Type Motif 17 (NUDT17))

Autre désignation: NUDT17 (NUDT17 Produits)

Synonymes: anticorps 2410015C20Rik, anticorps RGD1565469, anticorps zgc:114128, anticorps nudix hydrolase 17, anticorps nudix (nucleoside diphosphate linked moiety X)-type motif 17, anticorps NUDT17, anticorps Nudt17, anticorps nudt17

Sujet: NUDT17 belongs to the Nudix hydrolase family. It probably mediates the hydrolysis of some nucleoside diphosphate derivatives.

Poids moléculaire: 36 kDa (MW of target protein)