TUBA3C anticorps (N-Term)

N° du produit ABIN630708

Détail du produit anti-TUBA3C anticorps

Antigène: TUBA3C (Tubulin, Alpha, 3C (TUBA3C))

Épitope: N-Term

Reactivité: Humain, Souris, Rat, Drosophila melanogaster, C. elegans

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TUBA3C est non-conjugé

Application: Western Blotting (WB)

Specificité: Alpha Tubulin 3 C antibody was raised against the N terminal of TUBA3

Purification: Affinity purified

Immunogène: alpha Tubulin 3 C antibody was raised using the N terminal of TUBA3 corresponding to a region with amino acids VDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIVDL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

alpha Tubulin 3C Blocking Peptide, catalog no. 33R-9469, is also available for use as a blocking control in assays to test for specificity of this alpha Tubulin 3C antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TUBA0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TUBA3C

Antigène: TUBA3C (Tubulin, Alpha, 3C (TUBA3C))

Abstract: TUBA3C Produits

Synonymes: anticorps TUBA2, anticorps bA408E5.3, anticorps TUBA1A, anticorps TUBA3, anticorps TUBA3C, anticorps TUBA3D, anticorps 3t, anticorps ALPHA 84D, anticorps CG2512, anticorps D.m.ALPHA-84D, anticorps DTA4, anticorps Dmel\CG2512, anticorps T, anticorps Tub, anticorps Tub1A, anticorps aTub84D, anticorps alpha-Tub, anticorps alpha-Tub84D, anticorps alpha-tub, anticorps alpha-tub84D, anticorps alpha-tubulin, anticorps alpha3, anticorps alpha3t, anticorps alpha84D, anticorps alphaTUB, anticorps alphaTUB84D, anticorps alphaTub, anticorps alphaTub3, anticorps alphaTub84, anticorps tuba2, anticorps tuba3c, anticorps tuba3d, anticorps GRMZM2G153292, anticorps TUA2, anticorps zgc:73108, anticorps tubulin alpha 3c, anticorps tubulin, alpha 3A, anticorps tubulin alpha like 3, anticorps tubulin alpha-1B chain, anticorps tubulin alpha-1A chain, anticorps alpha-Tubulin at 84D, anticorps tubulin alpha 3c S homeolog, anticorps tubulin alpha-2 chain-like, anticorps tubulin, alpha 2, anticorps TUBA3C, anticorps Tuba3a, anticorps TUBAL3, anticorps LOC610636, anticorps LOC782966, anticorps alphaTub84D, anticorps tuba3c.S, anticorps LOC103643947, anticorps tuba2

Sujet: Microtubules of the eukaryotic cytoskeleton perform essential and diverse functions and are composed of a heterodimer of alpha and beta tubulin. The genes encoding these microtubule constituents are part of the tubulin superfamily, which is composed of six distinct families. Genes from the alpha, beta and gamma tubulin families are found in all eukaryotes. The alpha and beta tubulins represent the major components of microtubules, while gamma tubulin plays a critical role in the nucleation of microtubule assembly. There are multiple alpha and beta tubulin genes and they are highly conserved among and between species.

Poids moléculaire: 50 kDa (MW of target protein)

Pathways: Dynamique des Microtubules