ITGB1BP3 anticorps (Middle Region)
-
- Antigène Voir toutes ITGB1BP3 Anticorps
- ITGB1BP3 (Integrin beta 1 Binding Protein 3 (ITGB1BP3))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp ITGB1BP3 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- ITGB1 BP3 antibody was raised against the middle region of ITGB1 P3
- Purification
- Affinity purified
- Immunogène
- ITGB1 BP3 antibody was raised using the middle region of ITGB1 P3 corresponding to a region with amino acids YKPLVDLYSRRYFLTVPYEECKWRRSTRNYTVPDPPGLFDGHVWPMYQKY
- Top Product
- Discover our top product ITGB1BP3 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
ITGB1BP3 Blocking Peptide, catalog no. 33R-10154, is also available for use as a blocking control in assays to test for specificity of this ITGB1BP3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ITGB0 P3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- ITGB1BP3 (Integrin beta 1 Binding Protein 3 (ITGB1BP3))
- Autre désignation
- ITGB1BP3 (ITGB1BP3 Produits)
- Synonymes
- anticorps ITGB1BP3, anticorps MIBP, anticorps NRK2, anticorps itgb1bp3, anticorps 2310015C21Rik, anticorps Itgb1bp3, anticorps Mibp, anticorps zgc:103408, anticorps nicotinamide riboside kinase 2, anticorps integrin beta 1 binding protein 3, anticorps nicotinamide riboside kinase 2 S homeolog, anticorps NMRK2, anticorps ITGB1BP3, anticorps nmrk2.S, anticorps nmrk2, anticorps Nmrk2
- Sujet
- ITGB1BP3 catalyzes the phosphorylation of nicotinamide riboside (NR) and nicotinic acid riboside (NaR) to form nicotinamide mononucleotide (NMN) and nicotinic acid mononucleotide (NaMN).
- Poids moléculaire
- 26 kDa (MW of target protein)
- Pathways
- Regulation of Muscle Cell Differentiation, Skeletal Muscle Fiber Development
-