EEF1B2 anticorps (Middle Region)
-
- Antigène Voir toutes EEF1B2 Anticorps
- EEF1B2 (Eukaryotic Translation Elongation Factor 1 beta 2 (EEF1B2))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp EEF1B2 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- EEF1 B2 antibody was raised against the middle region of EEF1 2
- Purification
- Affinity purified
- Immunogène
- EEF1 B2 antibody was raised using the middle region of EEF1 2 corresponding to a region with amino acids VKKALGKYGPADVEDTTGSGATDSKDDDDIDLFGSDDEEESEEAKRLREE
- Top Product
- Discover our top product EEF1B2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
EEF1B2 Blocking Peptide, catalog no. 33R-9624, is also available for use as a blocking control in assays to test for specificity of this EEF1B2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EEF0 2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- EEF1B2 (Eukaryotic Translation Elongation Factor 1 beta 2 (EEF1B2))
- Autre désignation
- EEF1B2 (EEF1B2 Produits)
- Synonymes
- anticorps EEF1B, anticorps EEF1B1, anticorps EF1B, anticorps 2810017J07Rik, anticorps Eef1b, anticorps fj06d02, anticorps wu:fj06d02, anticorps zgc:56277, anticorps zgc:86802, anticorps eef1b, anticorps ef1b, anticorps MGC89655, anticorps eukaryotic translation elongation factor 1 beta 2, anticorps eukaryotic translation elongation factor 1 beta 2 L homeolog, anticorps EEF1B2, anticorps Eef1b2, anticorps eef1b2, anticorps eef1b2.L
- Sujet
- EEF1B2 is a translation elongation factor. The protein is a guanine nucleotide exchange factor involved in the transfer of aminoacylated tRNAs to the ribosome. This gene encodes a translation elongation factor. The protein is a guanine nucleotide exchange factor involved in the transfer of aminoacylated tRNAs to the ribosome. Alternative splicing results in three transcript variants which differ only in the 5' UTR.
- Poids moléculaire
- 25 kDa (MW of target protein)
-