CEP55 anticorps (Middle Region)
-
- Antigène Voir toutes CEP55 Anticorps
- CEP55 (Centrosomal Protein 55kDa (CEP55))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp CEP55 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- CEP55 antibody was raised against the middle region of CEP55
- Purification
- Affinity purified
- Immunogène
- CEP55 antibody was raised using the middle region of CEP55 corresponding to a region with amino acids TLDFENEKLDRQHVQHQLHVILKELRKARNQITQLESLKQLHEFAITEPL
- Top Product
- Discover our top product CEP55 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
CEP55 Blocking Peptide, catalog no. 33R-9162, is also available for use as a blocking control in assays to test for specificity of this CEP55 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CEP55 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- CEP55 (Centrosomal Protein 55kDa (CEP55))
- Autre désignation
- CEP55 (CEP55 Produits)
- Synonymes
- anticorps C10orf3, anticorps CT111, anticorps URCC6, anticorps RGD1305340, anticorps 1200008O12Rik, anticorps 2700032M20Rik, anticorps centrosomal protein 55, anticorps CEP55, anticorps Cep55
- Sujet
- CEP55 plays a role in mitotic exit and cytokinesis. Not required for microtubule nucleation.
- Poids moléculaire
- 54 kDa (MW of target protein)
-