MNS1 anticorps (Middle Region)
-
- Antigène Voir toutes MNS1 Anticorps
- MNS1 (Meiosis-Specific Nuclear Structural 1 (MNS1))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp MNS1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- MNS1 antibody was raised against the middle region of MNS1
- Purification
- Affinity purified
- Immunogène
- MNS1 antibody was raised using the middle region of MNS1 corresponding to a region with amino acids KVQENEEKRLQLQNALTQKLEEMLRQREDLEQVRQELYQEEQAEIYKSKL
- Top Product
- Discover our top product MNS1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
MNS1 Blocking Peptide, catalog no. 33R-4719, is also available for use as a blocking control in assays to test for specificity of this MNS1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MNS1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- MNS1 (Meiosis-Specific Nuclear Structural 1 (MNS1))
- Autre désignation
- MNS1 (MNS1 Produits)
- Synonymes
- anticorps SPATA40, anticorps sb:cb494, anticorps zgc:65845, anticorps AW546487, anticorps meiosis specific nuclear structural 1, anticorps meiosis-specific nuclear structural 1, anticorps meiosis-specific nuclear structural protein 1, anticorps MNS1, anticorps mns1, anticorps Mns1
- Sujet
- This gene encodes a protein highly similar to the mouse meiosis-specific nuclear structural 1 protein.
- Poids moléculaire
- 60 kDa (MW of target protein)
-