PARP6 anticorps

N° du produit ABIN630726

Détail du produit anti-PARP6 anticorps

Antigène: PARP6 (Poly (ADP-Ribose) Polymerase Family, Member 6 (PARP6))

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PARP6 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Purification: Affinity purified

Immunogène: PARP6 antibody was raised using a synthetic peptide corresponding to a region with amino acids KLPLSRLKFMHTSHQFLLLSSPPAKEARFRTAKKLYGSTFAFHGSHIENW

Information d'application

Indications d'application: WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PARP6 Blocking Peptide, catalog no. 33R-4528, is also available for use as a blocking control in assays to test for specificity of this PARP6 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PARP6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PARP6

Antigène: PARP6 (Poly (ADP-Ribose) Polymerase Family, Member 6 (PARP6))

Autre désignation: PARP6 (PARP6 Produits)

Synonymes: anticorps ARTD17, anticorps PARP-6-B1, anticorps PARP-6-C, anticorps pART17, anticorps 1700119G14Rik, anticorps 2310028P13Rik, anticorps 3110038K10Rik, anticorps C030013N01Rik, anticorps PARP-6, anticorps RGD1310937, anticorps zgc:92798, anticorps poly(ADP-ribose) polymerase family member 6, anticorps poly (ADP-ribose) polymerase family, member 6, anticorps poly(ADP-ribose) polymerase family member 6 S homeolog, anticorps poly [ADP-ribose] polymerase 6, anticorps poly (ADP-ribose) polymerase family, member 6a, anticorps PARP6, anticorps Parp6, anticorps parp6, anticorps parp6.S, anticorps LOC100475149, anticorps parp6a

Sujet: Poly(ADP-ribose) polymerases (PARPs) constitute a large family of 18 proteins, encoded by different genes and displaying a conserved catalytic domain. They are involved in DNA-damage-dependent post-translational modification of histones and other nuclear proteins that contributes to the survival of injured proliferating cells.

Poids moléculaire: 59 kDa (MW of target protein)