QTRT1 anticorps
-
- Antigène Voir toutes QTRT1 Anticorps
- QTRT1 (Queuine tRNA-Ribosyltransferase 1 (QTRT1))
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp QTRT1 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- QTRT1 antibody was raised using a synthetic peptide corresponding to a region with amino acids KDKPRYLMGVGYATDLVVCVALGCDMFDCVFPTRTARFGSALVPTGNLQL
- Top Product
- Discover our top product QTRT1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
QTRT1 Blocking Peptide, catalog no. 33R-4290, is also available for use as a blocking control in assays to test for specificity of this QTRT1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of QTRT1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- QTRT1 (Queuine tRNA-Ribosyltransferase 1 (QTRT1))
- Autre désignation
- QTRT1 (QTRT1 Produits)
- Synonymes
- anticorps CG4947, anticorps Dmel\\CG4947, anticorps TGT, anticorps tgt, anticorps zgc:66378, anticorps FP3235, anticorps TGUT, anticorps 2610028E17Rik, anticorps Tgt, anticorps Tgut, anticorps tRNA-guanine transglycosylase, anticorps queuine tRNA-ribosyltransferase 1 S homeolog, anticorps queuine tRNA-ribosyltransferase 1, anticorps queuine tRNA-ribosyltransferase catalytic subunit 1, anticorps Tgt, anticorps Olsu_0732, anticorps Palpr_1298, anticorps Riean_1227, anticorps Calni_1240, anticorps Ftrac_0312, anticorps Ocepr_1541, anticorps Sulku_0977, anticorps Tmar_0854, anticorps Bache_2323, anticorps Nitsa_1291, anticorps Isop_1657, anticorps Despr_0021, anticorps Pedsa_1842, anticorps Corgl_1148, anticorps Mahau_0921, anticorps Theth_0831, anticorps qtrt1.S, anticorps qtrt1, anticorps QTRT1, anticorps Qtrt1
- Sujet
- TRNA-guanine transglycosylase synthesizes queuosine (Q), which is found in tRNAs that recognise NAU and NAC codons, encoding tyr, asn, asp, and his. Prokaryotic TGT is a single protein of 43 kDa. In contrast, mammalian TGT appears to be a heterodimer consisting of a 60 kDa subunit and a 43 kDa catalytic subunit.
- Poids moléculaire
- 44 kDa (MW of target protein)
- Pathways
- Ribonucleoside Biosynthetic Process
-