FAD Synthetase anticorps

N° du produit ABIN630740

Détail du produit anti-FAD Synthetase anticorps

Antigène: FAD Synthetase

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FAD Synthetase est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: FLAD1 antibody was raised using a synthetic peptide corresponding to a region with amino acids PGRSVTAGIIIVGDEILKGHTQDTNTFFLCRTLRSLGVQVCRVSVVPDEV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FLAD1 Blocking Peptide, catalog no. 33R-7130, is also available for use as a blocking control in assays to test for specificity of this FLAD1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FLAD1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur FAD Synthetase

Antigène: FAD Synthetase

Autre désignation: FLAD1 (FAD Synthetase Produits)

Synonymes: anticorps wu:fa92c06, anticorps zgc:91843, anticorps fad1, anticorps fads, anticorps pp591, anticorps FAD1, anticorps FADS, anticorps RP11-307C12.7, anticorps A930017E24Rik, anticorps Pp591, anticorps FAD synthetase (predicted), anticorps FAD synthetase, anticorps flavin adenine dinucleotide synthetase 1, anticorps flavin adenine dinucleotide synthetase 1 L homeolog, anticorps SPCC1235.04c, anticorps GY4MC1_1590, anticorps SpiBuddy_1392, anticorps Psed_2275, anticorps Spico_0597, anticorps Trebr_1967, anticorps Geoth_1673, anticorps Ccan_14090, anticorps flad1, anticorps FLAD1, anticorps flad1.L, anticorps Flad1

Sujet: FLAD1 catalyzes the adenylation of flavin mononucleotide (FMN) to form flavin adenine dinucleotide (FAD) coenzyme.

Poids moléculaire: 65 kDa (MW of target protein)