METTL11B anticorps (C-Term)

N° du produit ABIN630741

Détail du produit anti-METTL11B anticorps

Antigène: METTL11B (C1ORF184) (Chromosome 10 Open Reading Frame 184 (C1ORF184))

Épitope: C-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp METTL11B est non-conjugé

Application: Western Blotting (WB)

Specificité: C1 ORF184 antibody was raised against the C terminal Of C1 rf184

Purification: Affinity purified

Immunogène: C1 ORF184 antibody was raised using the C terminal Of C1 rf184 corresponding to a region with amino acids NVAREGCILDLSDSSVTRDMDILRSLIRKSGLVVLGQEKQDGFPEQCIPV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

C1ORF184 Blocking Peptide, catalog no. 33R-6909, is also available for use as a blocking control in assays to test for specificity of this C1ORF184 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF184 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur METTL11B

Antigène: METTL11B (C1ORF184) (Chromosome 10 Open Reading Frame 184 (C1ORF184))

Autre désignation: C1ORF184 (C1ORF184 Produits)

Synonymes: anticorps C1orf184, anticorps HOMT1B, anticorps NTM1B, anticorps Gm207, anticorps RGD1564106, anticorps methyltransferase like 11B, anticorps METTL11B, anticorps Mettl11b, anticorps mettl11b

Sujet: C1orf184 (Alpha-N-methyltransferase) methylates the N-terminus of target proteins containing the N-terminal motif [Ala/Pro/Ser]-Pro-Lys when the initiator Met is cleaved. Specifically catalyzes mono-, di- or tri-methylation of exposed alpha-amino group of Ala, Pro or Ser residue in the [Ala/Pro/Ser]-Pro-Lys motif.

Poids moléculaire: 32 kDa (MW of target protein)