ALG1L3P anticorps (C-Term)
-
- Antigène Tous les produits ALG1L3P
- ALG1L3P (Asparagine-Linked Glycosylation 1-Like 3, Pseudogene (ALG1L3P))
- Épitope
- C-Term
- Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp ALG1L3P est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- LOC650515 antibody was raised against the C terminal of LOC650515
- Purification
- Affinity purified
- Immunogène
- LOC650515 antibody was raised using the C terminal of LOC650515 corresponding to a region with amino acids VQTVLPLVMDTELLGQRLKPQGPCCPSRSFFSESQGKSFRVAPPSGQKLI
-
-
- Indications d'application
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
LOC650515 Blocking Peptide, catalog no. 33R-9764, is also available for use as a blocking control in assays to test for specificity of this LOC650515 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LOC650515 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- ALG1L3P (Asparagine-Linked Glycosylation 1-Like 3, Pseudogene (ALG1L3P))
- Abstract
- ALG1L3P Produits
- Sujet
- The sequence of LOC650515 is derived from an annotated genomic sequence (NW_922073) using gene prediction method: GNOMON, supported by EST evidence. The exact function of LOC650515 remains unknown.
- Poids moléculaire
- 39 kDa (MW of target protein)
-