NUP35 anticorps (C-Term)

N° du produit ABIN630746

Détail du produit anti-NUP35 anticorps

Antigène: NUP35 (Nucleoporin 35kDa (NUP35))

Épitope: C-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp NUP35 est non-conjugé

Application: Western Blotting (WB)

Specificité: NUP35 antibody was raised against the C terminal of NUP35

Purification: Affinity purified

Immunogène: NUP35 antibody was raised using the C terminal of NUP35 corresponding to a region with amino acids STPRISTMRPLATAYKASTSDYQVISDRQTPKKDESLVSKAMEYMFGW

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

NUP35 Blocking Peptide, catalog no. 33R-8881, is also available for use as a blocking control in assays to test for specificity of this NUP35 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NUP35 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur NUP35

Antigène: NUP35 (Nucleoporin 35kDa (NUP35))

Autre désignation: NUP35 (NUP35 Produits)

Synonymes: anticorps MGC64281, anticorps nup53, anticorps 2310006I24Rik, anticorps 35kDa, anticorps 5330402E05Rik, anticorps MP44, anticorps NO44, anticorps fj68d11, anticorps wu:fj68d11, anticorps zgc:65979, anticorps NP44, anticorps NUP53, anticorps nucleoporin 35kDa L homeolog, anticorps nucleoporin 35, anticorps nucleoporin 35kDa, anticorps nucleoporin NUP53, anticorps nup35.L, anticorps NUP35, anticorps nup35, anticorps CpipJ_CPIJ009421, anticorps Nup35

Sujet: NUP35 is a member of the nucleoporin family. The protein is localized to the nuclear rim and is part of the nuclear pore complex (NPC). All molecules entering or leaving the nucleus either diffuse through or are actively transported by the NPC. This gene encodes a member of the nucleoporin family. The protein is localized to the nuclear rim and is part of the nuclear pore complex (NPC). All molecules entering or leaving the nucleus either diffuse through or are actively transported by the NPC.

Poids moléculaire: 35 kDa (MW of target protein)