GGN anticorps (N-Term)
-
- Antigène Voir toutes GGN Anticorps
- GGN (Gametogenetin (GGN))
-
Épitope
- N-Term
-
Reactivité
- Humain, Rat, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp GGN est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- GGN antibody was raised against the N terminal of GGN
- Purification
- Affinity purified
- Immunogène
- GGN antibody was raised using the N terminal of GGN corresponding to a region with amino acids GPSKWQKPAGTPVPRIRRLLEASHRGQGDPPSLRPLKPPPPPRQLSVKDT
- Top Product
- Discover our top product GGN Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
GGN Blocking Peptide, catalog no. 33R-3484, is also available for use as a blocking control in assays to test for specificity of this GGN antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GGN antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- GGN (Gametogenetin (GGN))
- Autre désignation
- GGN (GGN Produits)
- Synonymes
- anticorps AI593290, anticorps gametogenetin, anticorps GGN, anticorps Ggn
- Sujet
- GGN may be involved in spermatogenesis.
- Poids moléculaire
- 67 kDa (MW of target protein)
-