PHLDA1 anticorps (Middle Region)
-
- Antigène Voir toutes PHLDA1 Anticorps
- PHLDA1 (Pleckstrin Homology-Like Domain, Family A, Member 1 (PHLDA1))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp PHLDA1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- PHLDA1 antibody was raised against the middle region of PHLDA1
- Purification
- Affinity purified
- Immunogène
- PHLDA1 antibody was raised using the middle region of PHLDA1 corresponding to a region with amino acids PAVASLEPPVKLKELHFSNMKTVDCVERKGKYMYFTVVMAEGKEIDFRCP
- Top Product
- Discover our top product PHLDA1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
PHLDA1 Blocking Peptide, catalog no. 33R-6986, is also available for use as a blocking control in assays to test for specificity of this PHLDA1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PHLDA1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- PHLDA1 (Pleckstrin Homology-Like Domain, Family A, Member 1 (PHLDA1))
- Autre désignation
- PHLDA1 (PHLDA1 Produits)
- Synonymes
- anticorps DT1P1B11, anticorps PHRIP, anticorps TDAG51, anticorps Tdag, anticorps pleckstrin homology like domain family A member 1, anticorps pleckstrin homology like domain, family A, member 1, anticorps pleckstrin homology-like domain, family A, member 1, anticorps pleckstrin homology-like domain, family A, member 1 L homeolog, anticorps PHLDA1, anticorps Phlda1, anticorps phlda1.L
- Sujet
- PHLDA1 is an evolutionarily conserved proline-histidine rich nuclear protein. It may play an important role in the anti-apoptotic effects of insulin-like growth factor-1.
- Poids moléculaire
- 45 kDa (MW of target protein)
-