BLVRB anticorps (Middle Region)
-
- Antigène Voir toutes BLVRB Anticorps
- BLVRB (Flavin Reductase (BLVRB))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp BLVRB est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- BLVRB antibody was raised against the middle region of BLVRB
- Purification
- Affinity purified
- Immunogène
- BLVRB antibody was raised using the middle region of BLVRB corresponding to a region with amino acids GLKYVAVMPPHIGDQPLTGAYTVTLDGRGPSRVISKHDLGHFMLRCLTTD
- Top Product
- Discover our top product BLVRB Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
BLVRB Blocking Peptide, catalog no. 33R-3403, is also available for use as a blocking control in assays to test for specificity of this BLVRB antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BLVRB antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- BLVRB (Flavin Reductase (BLVRB))
- Autre désignation
- BLVRB (BLVRB Produits)
- Synonymes
- anticorps BVRB, anticorps FLR, anticorps SDR43U1, anticorps biliverdin reductase B (flavin reductase (NADPH)), anticorps biliverdin reductase B, anticorps Blvrb, anticorps BLVRB
- Sujet
- BLVRB catalyzes electron transfer from reduced pyridine nucleotides to flavins as well as methylene blue, pyrroloquinoline quinone, riboflavin, or methemoglobin. BLVRB has possible role in protecting cells from oxidative damage or in regulating iron metabolism. In the liver, BLVRB converts biliverdin to bilirubin.
- Poids moléculaire
- 22 kDa (MW of target protein)
-