Myosin IC anticorps (N-Term)

N° du produit ABIN630755

Détail du produit anti-Myosin IC anticorps

Antigène: Myosin IC (MYO1C)

Épitope: N-Term

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Myosin IC est non-conjugé

Application: Western Blotting (WB)

Specificité: Myosin Ic antibody was raised against the N terminal of MYO1 C

Purification: Affinity purified

Immunogène: Myosin Ic antibody was raised using the N terminal of MYO1 C corresponding to a region with amino acids NPVLEAFGNAKTLRNDNSSRFGKYMDVQFDFKGAPVGGHILSYLLEKSRV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Myosin Ic Blocking Peptide, catalog no. 33R-6834, is also available for use as a blocking control in assays to test for specificity of this Myosin Ic antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MYO0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Myosin IC

Antigène: Myosin IC (MYO1C)

Autre désignation: Myosin Ic (MYO1C Produits)

Synonymes: anticorps MMI-beta, anticorps MMIb, anticorps NMI, anticorps myr2, anticorps C80397, anticorps MYO1E, anticorps mm1beta, anticorps Myr2, anticorps mmib, anticorps myo1c, anticorps nm1, anticorps Myo1c, anticorps Myosin-Ic, anticorps MMI-beta-A, anticorps MMIb-A, anticorps DDBDRAFT_0202969, anticorps DDBDRAFT_0215355, anticorps DDB_0202969, anticorps DDB_0215355, anticorps 43CD, anticorps CG2146, anticorps Didum, anticorps DmV, anticorps Dmel\CG2146, anticorps M5, anticorps MYOV, anticorps Myo1C, anticorps Myo5, anticorps MyoV, anticorps MyoV43CD, anticorps NEST:bs14c05, anticorps NMC7, anticorps dmM5, anticorps myoV, anticorps soy, anticorps myosin IC, anticorps myosin 1C, anticorps myosin IC L homeolog, anticorps myosin Ic, paralog b, anticorps myosin Ic, paralog a, anticorps myosin IC S homeolog, anticorps class I myosin, anticorps dilute class unconventional myosin, anticorps MYO1C, anticorps Myo1c, anticorps myo1c.L, anticorps myo1cb, anticorps myo1c, anticorps myo1ca, anticorps myo1c.S, anticorps myoC, anticorps didum

Sujet: This gene encodes a member of the unconventional myosin protein family, which are actin-based molecular motors. The protein is found in the cytoplasm, and one isoform with a unique N-terminus is also found in the nucleus.

Poids moléculaire: 113 kDa (MW of target protein)

Pathways: Platelet-derived growth Factor Receptor Signaling