ACTR1A anticorps

N° du produit ABIN630759

Détail du produit anti-ACTR1A anticorps

Antigène: ACTR1A (Alpha Centractin (ACTR1A))

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ACTR1A est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: ACTR1 A antibody was raised using a synthetic peptide corresponding to a region with amino acids AIKERACYLSINPQKDETLETEKAQYYLPDGSTIEIGPSRFRAPELLFRP

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ACTR1A Blocking Peptide, catalog no. 33R-1269, is also available for use as a blocking control in assays to test for specificity of this ACTR1A antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACTR0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ACTR1A

Antigène: ACTR1A (Alpha Centractin (ACTR1A))

Autre désignation: ACTR1A (ACTR1A Produits)

Synonymes: anticorps ARP1, anticorps CTRN1, anticorps Arp1, anticorps alpha-Arp1, anticorps arp1, anticorps centractin, anticorps ctrn1, anticorps ACTR1A, anticorps ARP1 actin related protein 1 homolog A, anticorps ARP1 actin-related protein 1A, centractin alpha, anticorps ARP1 actin-related protein 1 homolog A, centractin alpha, anticorps ARP1 actin related protein 1 homolog A L homeolog, anticorps alpha-centractin, anticorps actin-2, anticorps ACTR1A, anticorps Actr1a, anticorps actr1a.L, anticorps actr1a, anticorps PTRG_02540, anticorps PAAG_06972, anticorps MCYG_01044, anticorps VDBG_00685, anticorps MGYG_00946, anticorps DICPUDRAFT_88548, anticorps PGTG_04034, anticorps Tsp_06409

Sujet: ACTR1A is a 42.6 kDa subunit of dynactin, a macromolecular complex consisting of 10-11 subunits ranging in size from 22 to 150 kDa. Dynactin binds to both microtubules and cytoplasmic dynein. It is involved in a diverse array of cellular functions, including ER-to-Golgi transport, the centripetal movement of lysosomes and endosomes, spindle formation, chromosome movement, nuclear positioning, and axonogenesis. This subunit is present in 8-13 copies per dynactin molecule, and is the most abundant molecule in the dynactin complex. It is an actin-related protein, and is approximately 60% identical at the amino acid level to conventional actin.

Poids moléculaire: 41 kDa (MW of target protein)

Pathways: M Phase