Chromosome 5 Open Reading Frame 39 (C5orf39) (N-Term) anticorps

N° du produit ABIN630761

Détail du produit

Antigène: Chromosome 5 Open Reading Frame 39 (C5orf39)

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Inconjugué

Application: Western Blotting (WB)

Specificité: C5 ORF39 antibody was raised against the N terminal Of C5 rf39

Purification: Affinity purified

Immunogène: C5 ORF39 antibody was raised using the N terminal Of C5 rf39 corresponding to a region with amino acids EQHFLGCVKRAWDSAEVAPEPQPPPIVSSEDRGPWPLPLYPVLGEYSLDS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

C5ORF39 Blocking Peptide, catalog no. 33R-2665, is also available for use as a blocking control in assays to test for specificity of this C5ORF39 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF39 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détail du antigène

Antigène: Chromosome 5 Open Reading Frame 39 (C5orf39)

Autre désignation: C5ORF39 (C5orf39 Produits)

Synonymes: anticorps AX2R, anticorps AXIIR, anticorps C5orf39, anticorps annexin A2 receptor, anticorps ANXA2R

Sujet: C5orf39 may act as a receptor for annexin II on marrow stromal cells to induce osteoclast formation.

Poids moléculaire: 22 kDa (MW of target protein)