GTDC1 anticorps (N-Term)

N° du produit ABIN630762

Détail du produit anti-GTDC1 anticorps

Antigène: GTDC1 (Glycosyltransferase-Like Domain Containing 1 (GTDC1))

Épitope: N-Term

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GTDC1 est non-conjugé

Application: Western Blotting (WB)

Specificité: GTDC1 antibody was raised against the N terminal of GTDC1

Purification: Affinity purified

Immunogène: GTDC1 antibody was raised using the N terminal of GTDC1 corresponding to a region with amino acids CQERDFQYGYNQILSCLVADVVVFNSVFNMESFLTSMGKFMKLIPDHRPK

Information d'application

Indications d'application: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GTDC1 Blocking Peptide, catalog no. 33R-1780, is also available for use as a blocking control in assays to test for specificity of this GTDC1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GTDC1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur GTDC1

Antigène: GTDC1 (Glycosyltransferase-Like Domain Containing 1 (GTDC1))

Autre désignation: GTDC1 (GTDC1 Produits)

Synonymes: anticorps Hmat-Xa, anticorps mat-Xa, anticorps E330008O22Rik, anticorps zgc:110568, anticorps glycosyltransferase like domain containing 1, anticorps glycosyltransferase-like domain containing 1, anticorps glycosyltransferase like domain containing 1 S homeolog, anticorps GTDC1, anticorps Gtdc1, anticorps gtdc1.S, anticorps gtdc1

Sujet: The function of GTDC1 protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 52 kDa (MW of target protein)