Homeotic Protein Proboscipedia anticorps (Middle Region)

N° du produit ABIN630765

Détail du produit anti-Homeotic Protein Proboscipedia anticorps

Antigène: Homeotic Protein Proboscipedia (PB)

Épitope: Middle Region

Reactivité: Drosophila melanogaster

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Homeotic Protein Proboscipedia est non-conjugé

Application: Western Blotting (WB)

Specificité: PB antibody was raised against the middle region of Pb

Purification: Affinity purified

Immunogène: PB antibody was raised using the middle region of Pb corresponding to a region with amino acids DLTERQVKVWFQNRRMKHKRQTLSKTDDEDNKDSLKGDDDQSDSNSNSKK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PB Blocking Peptide, catalog no. 33R-2067, is also available for use as a blocking control in assays to test for specificity of this PB antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PB antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Homeotic Protein Proboscipedia

Antigène: Homeotic Protein Proboscipedia (PB)

Autre désignation: PB (PB Produits)

Sujet: Pb is a sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis. It controls development of mouthparts, and labial and maxillary palps.

Poids moléculaire: 83 kDa (MW of target protein)