APPBP2 anticorps
-
- Antigène Voir toutes APPBP2 Anticorps
- APPBP2 (Amyloid beta Precursor Protein (Cytoplasmic Tail) Binding Protein 2 (APPBP2))
-
Reactivité
- Humain, Rat, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp APPBP2 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- APPBP2 antibody was raised using a synthetic peptide corresponding to a region with amino acids QASKACVVKREFKKAEQLIKHAVYLARDHFGSKHPKYSDTLLDYGFYLLN
- Top Product
- Discover our top product APPBP2 Anticorps primaire
-
-
- Indications d'application
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
APPBP2 Blocking Peptide, catalog no. 33R-7479, is also available for use as a blocking control in assays to test for specificity of this APPBP2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of APPBP2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- APPBP2 (Amyloid beta Precursor Protein (Cytoplasmic Tail) Binding Protein 2 (APPBP2))
- Autre désignation
- APPBP2 (APPBP2 Produits)
- Synonymes
- anticorps HS.84084, anticorps PAT1, anticorps 1300003O07Rik, anticorps AI465480, anticorps zgc:76971, anticorps wu:fb78e11, anticorps wu:fc25c09, anticorps APPBP2, anticorps DKFZp459F0530, anticorps amyloid beta precursor protein binding protein 2, anticorps amyloid beta precursor protein (cytoplasmic tail) binding protein 2, anticorps amyloid beta precursor protein (cytoplasmic tail) binding protein 2 S homeolog, anticorps APPBP2, anticorps Appbp2, anticorps appbp2, anticorps appbp2.S
- Sujet
- APPBP2 interacts with microtubules and is functionally associated with beta-amyloid precursor protein transport and/or processing. The beta-amyloid precursor protein is a cell surface protein with signal-transducing properties, and it is thought to play a role in the pathogenesis of Alzheimer's disease. APPBP2 has been found to be highly expressed in breast cancer.
- Poids moléculaire
- 67 kDa (MW of target protein)
-