METAP1 anticorps (N-Term)

N° du produit ABIN630774

Détail du produit anti-METAP1 anticorps

Antigène: METAP1 (Methionyl Aminopeptidase 1 (METAP1))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp METAP1 est non-conjugé

Application: Western Blotting (WB)

Specificité: METAP1 antibody was raised against the N terminal of METAP1

Purification: Affinity purified

Immunogène: METAP1 antibody was raised using the N terminal of METAP1 corresponding to a region with amino acids GDINTDPWAGYRYTGKLRPHYPLMPTRPVPSYIQRPDYADHPLGMSESEQ

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

METAP1 Blocking Peptide, catalog no. 33R-3198, is also available for use as a blocking control in assays to test for specificity of this METAP1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of METAP1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur METAP1

Antigène: METAP1 (Methionyl Aminopeptidase 1 (METAP1))

Autre désignation: METAP1 (METAP1 Produits)

Synonymes: anticorps MGC64362, anticorps METAP1, anticorps metap1, anticorps DKFZp468B1413, anticorps LOC100228334, anticorps DDBDRAFT_0205763, anticorps DDBDRAFT_0235405, anticorps DDB_0205763, anticorps DDB_0235405, anticorps MAP1A, anticorps MetAP1A, anticorps 1700029C17Rik, anticorps AW047992, anticorps mKIAA0094, anticorps Metap1, anticorps im:7047238, anticorps wu:fc84e12, anticorps zgc:110093, anticorps methionyl aminopeptidase 1 S homeolog, anticorps methionyl aminopeptidase 1, anticorps methionine aminopeptidase 1, anticorps methionyl aminopeptidase 1 L homeolog, anticorps metap1.S, anticorps METAP1, anticorps metap1, anticorps Metap1, anticorps metap1.L

Sujet: METAP1 removes the amino-terminal methionine from nascent proteins. METAP1 is required for normal progression through the cell cycle.

Poids moléculaire: 30 kDa (MW of target protein)

Pathways: Regulation of G-Protein Coupled Receptor Protein Signaling