GLT6D1 anticorps (Middle Region)
-
- Antigène Voir toutes GLT6D1 Anticorps
- GLT6D1 (Glycosyltransferase 6 Domain Containing 1 (GLT6D1))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp GLT6D1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- GLT6 D1 antibody was raised against the middle region of GLT6 1
- Purification
- Affinity purified
- Immunogène
- GLT6 D1 antibody was raised using the middle region of GLT6 1 corresponding to a region with amino acids FGVETLGPLVAQLHAWWYFRNTKNFPYERRPTSAACIPFGQGDFYYGNLM
- Top Product
- Discover our top product GLT6D1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
GLT6D1 Blocking Peptide, catalog no. 33R-2916, is also available for use as a blocking control in assays to test for specificity of this GLT6D1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GLT0 1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- GLT6D1 (Glycosyltransferase 6 Domain Containing 1 (GLT6D1))
- Autre désignation
- GLT6D1 (GLT6D1 Produits)
- Synonymes
- anticorps GLTDC1, anticorps GT6M7, anticorps GT6m7, anticorps Gltdc1, anticorps 4933411C14Rik, anticorps QtsA-20904, anticorps glycosyltransferase 6 domain containing 1, anticorps GLT6D1, anticorps Glt6d1
- Sujet
- GLT6D1 is a single-pass type II membrane protein. It belongs to the glycosyltransferase 6 family. The exact function of GLT6D1 remains unknown.
- Poids moléculaire
- 32 kDa (MW of target protein)
-