SPTAN1 anticorps
-
- Antigène Voir toutes SPTAN1 Anticorps
- SPTAN1 (Spectrin alpha Chain, Brain (SPTAN1))
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SPTAN1 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- SPTAN1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MDPSGVKVLETAEDIQERRQQVLDRYHRFKELSTLRRQKLEDSYRFQFFQ
- Top Product
- Discover our top product SPTAN1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
SPTAN1 Blocking Peptide, catalog no. 33R-5860, is also available for use as a blocking control in assays to test for specificity of this SPTAN1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SPTAN1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- SPTAN1 (Spectrin alpha Chain, Brain (SPTAN1))
- Autre désignation
- SPTAN1 (SPTAN1 Produits)
- Synonymes
- anticorps im:7157190, anticorps wu:fa20e05, anticorps wu:fb33g08, anticorps wu:fk32a10, anticorps zgc:112229, anticorps 2610027H02Rik, anticorps Spna-2, anticorps Spna2, anticorps EIEE5, anticorps NEAS, anticorps SPTA2, anticorps A2a, anticorps IPF, anticorps SPECA, anticorps spectrin alpha, non-erythrocytic 1, anticorps spectrin, alpha, non-erythrocytic 1, anticorps SPTAN1, anticorps sptan1, anticorps Sptan1
- Sujet
- Fodrin (SPTAN1), which seems to be involved in secretion, interacts with calmodulin in a calcium-dependent manner and is thus candidate for the calcium-dependent movement of the cytoskeleton at the membrane.
- Poids moléculaire
- 272 kDa (MW of target protein)
- Pathways
- Caspase Cascade in Apoptosis, Regulation of Actin Filament Polymerization
-