ALDOB anticorps (Middle Region)
-
- Antigène Voir toutes ALDOB Anticorps
- ALDOB (Aldolase B, Fructose-Bisphosphate (ALDOB))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp ALDOB est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- ALDOB antibody was raised against the middle region of ALDOB
- Purification
- Affinity purified
- Immunogène
- ALDOB antibody was raised using the middle region of ALDOB corresponding to a region with amino acids KLDQGGAPLAGTNKETTIQGLDGLSERCAQYKKDGVDFGKWRAVLRIADQ
- Top Product
- Discover our top product ALDOB Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
ALDOB Blocking Peptide, catalog no. 33R-4503, is also available for use as a blocking control in assays to test for specificity of this ALDOB antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ALDOB antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- ALDOB (Aldolase B, Fructose-Bisphosphate (ALDOB))
- Autre désignation
- ALDOB (ALDOB Produits)
- Synonymes
- anticorps aldb, anticorps aldo2, anticorps xaldb, anticorps ALDOB, anticorps aldob, anticorps ALDB, anticorps ALDO2, anticorps Aldo-2, anticorps Aldo2, anticorps BC016435, anticorps LIV10, anticorps fb25f09, anticorps wu:fb25f09, anticorps aldolase B, anticorps aldolase, fructose-bisphosphate B, anticorps aldolase, fructose-bisphosphate B S homeolog, anticorps aldolase b, fructose-bisphosphate, anticorps aldolase B, fructose-bisphosphate, anticorps xaldb, anticorps aldob, anticorps aldob.S, anticorps ALDOB, anticorps Aldob
- Sujet
- Fructose-1,6-bisphosphate aldolase (EC 4.1.2.13) is a tetrameric glycolytic enzyme that catalyzes the reversible conversion of fructose-1,6-bisphosphate to glyceraldehyde 3-phosphate and dihydroxyacetone phosphate. Vertebrates have 3 aldolase isozymes which are distinguished by their electrophoretic and catalytic properties. Differences indicate that aldolases A, B, and C are distinct proteins, the products of a family of related 'housekeeping' genes exhibiting developmentally regulated expression of the different isozymes. The developing embryo produces aldolase A, which is produced in even greater amounts in adult muscle where it can be as much as 5% of total cellular protein. In adult liver, kidney and intestine, aldolase A expression is repressed and aldolase B is produced. In brain and other nervous tissue, aldolase A and C are expressed about equally. There is a high degree of homology between aldolase A and C. Defects in ALDOB cause hereditary fructose intolerance.
- Poids moléculaire
- 39 kDa (MW of target protein)
-